SZ3CAS:; 2556443 73 1 - Purity > 98% | 0940-208333
- SKU:
- 0940-208333
- Availability:
- IN STOCK
Frequently bought together:
Description
SZ3CAS:; 2556443 73 1 - Purity > 98% | 0940-208333| Genprice Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Coenzyme Q10 CAS N° 303, 98, 0; Purity; 98% , 1 g | 0862, GP6626, 1G
$87.00
Coenzyme Q10 CAS N° 303, 98, 0; Purity; 98% , 1 g | 0862, GP6626, 1G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Patulin CAS N°149 29 1 - Purity; 98% | 0804-HY-N6779
$400.00
Patulin CAS N°149 29 1 - Purity; 98% | 0804-HY-N6779| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Brimonidine tartrate Purity 98% 100mg | 0804, HY, B0659
$249.00
Brimonidine tartrate Purity 98% 100mg | 0804, HY, B0659 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Dexmedetomidine Purity 98% , 50 mg | 0804, HY, 12719
$279.00
Dexmedetomidine Purity 98% , 50 mg | 0804, HY, 12719 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
AY 9944 Purity 98% | 0804, HY, 107420, 5mg
$276.00
AY 9944 Purity 98% | 0804, HY, 107420, 5mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
DAMGO Purity 98% , 5 mg | 0804, HY, P0210
$297.00
DAMGO Purity 98% , 5 mg | 0804, HY, P0210 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Microcystin, LW CAS N°157622, 02, 1, Purity; 98% | 0804, HY, N11679
$13,450.00
Microcystin, LW CAS N°157622, 02, 1, Purity; 98% | 0804, HY, N11679 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity; >98% | 0399, CSB, DT0293, 500mg
$2,249.00
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity; >98% | 0399, CSB, DT0293, 500mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab...
ICI 199441 Purity 98% , 5 mg | 0804, HY, 101205
$293.00
ICI 199441 Purity 98% , 5 mg | 0804, HY, 101205 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.