Synthetic Macrothele gigas Delta hexatoxin Mg1b - Biotin tagged | CSB-EP745067MAM(PS)-4MG
(No reviews yet)
Write a Review
- SKU:
- CSB-EP745067MAM(PS)-4MG
- Availability:
- IN STOCK
Frequently bought together:
Description
Synthetic Macrothele gigas Delta hexatoxin Mg1b - Biotin tagged | CSB-EP745067MAM(PS)-4MG| Genprice Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Synthetic Agelena orientalis U2 agatoxin Ao1s - Biotin tagged | CSB-EP316005AEQ(PS)-4MG
$1,865.00
Synthetic Agelena orientalis U2 agatoxin Ao1s - Biotin tagged | CSB-EP316005AEQ(PS)-4MG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by...
Synthetic Oxyopes takobius M oxotoxin Ot2d - Biotin tagged | 0399-CSB-EP307905OGA(PS)-4MG
$1,920.00
Synthetic Oxyopes takobius M oxotoxin Ot2d - Biotin tagged | 0399-CSB-EP307905OGA(PS)-4MG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by...
Human C1orf54 Polyclonal Antibody Biotin, conjugated | 0399, CSB, PA840992LD01HU, 100UG
$374.00
Human C1orf54 Polyclonal Antibody Biotin, conjugated | 0399, CSB, PA840992LD01HU, 100UG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by...
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-1MG
$2,554.00
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-1MG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to...
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-20UG
$1,180.00
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-20UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to...
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-100UG
$1,413.00
Recombinant Rabies virus Glycoprotein G - partial - Avi tag Biotinylated | 0399-CSB-EP325676RAF-B-100UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to...
Tag Removal Service; EP/YP; ≤1mg | 0399-CSB-TAG-removal-1MG
$108.00
Tag Removal Service; EP/YP; ≤1mg | 0399-CSB-TAG-removal-1MG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity; >98% | 0399, CSB, DT0293, 500mg
$2,249.00
FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity; >98% | 0399, CSB, DT0293, 500mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab...
Recombinant Human Interleukin 19 IL19 - Biotinylated | 0399-CSB-EP883391HU-B-20UG
$828.00
Recombinant Human Interleukin 19 IL19 - Biotinylated | 0399-CSB-EP883391HU-B-20UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...