NIST RUO standards Catalogue Manual of RUO reference material and Third Party NIST controlsThe products contain the fo … read more 16th Dec 2022 Lieven M G GEVAERT
Elisa protocol EU1059 a-Thalassemia (-SEA) PDF EU1015 AFP Quantitative (a-Fetoprotein) PDF EU1042 ANA (ANTI- … read more 27th May 2022 Lieven Gevaert
Description Additional Information Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose Additional Information Size: 100 µg View AllClose
Add to Cart Quick view TK Antibody | Gentaur Gentaur MSRP: Now: $340.00 Was: TK Antibody | 399-CSB-PA234835