Custom Service | 0171, Custom, 1
- SKU:
- 0171-Custom-1
- Availability:
- IN STOCK
Frequently bought together:
Description
Custom Service | 0171, Custom, 1 | Genprice Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
Cell License Fee | 0171, Custom, Cell
$4,629.00
Cell License Fee | 0171, Custom, Cell | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Custom 5’ UTR Reporter Lentiviral Vector Subcloning GFP | 0171, C451
$600.00
Custom 5’ UTR Reporter Lentiviral Vector Subcloning GFP | 0171, C451 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Custom 5’ UTR Reporter Lentiviral Vector Subcloning Luc | 0171, C452
$600.00
Custom 5’ UTR Reporter Lentiviral Vector Subcloning Luc | 0171, C452 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Custom AAV with DNA amplification 10^11 GC/ml AAV1 | 0171, C263
$33,129.00
Custom AAV with DNA amplification 10^11 GC/ml AAV1 | 0171, C263 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Custom AAV without DNA amplification 10^11 GC/ml AAV1 | 0171, C239, 3x100μl
$325.00
Custom AAV without DNA amplification 10^11 GC/ml AAV1 | 0171, C239, 3x100μl | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...
CRISPR Stable Knockout Cell Line Service | 0171, C142
$3,899.00
CRISPR Stable Knockout Cell Line Service | 0171, C142 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Silane PEG OH - 5000 | 0695-customization-2-1
$581.00
Silane PEG OH - 5000 | 0695-customization-2-1| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
CHO HCP Custom Antigen Conc. | 214, F553X, 1
$6,315.00
CHO HCP Custom Antigen Conc. | 214, F553X, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Customer service;Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399, CSB, CS P , 004
$925.00
Customer service;Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399, CSB, CS P , 004 | Genprice Distribution US, UK & Europe This product is guaranteed and...