Chemicals

ID Screen African Swine Fever Indirect | CFR00029, ASFS, 5P | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

ICI 199441 Purity 98% , 5 mg | 0804, HY, 101205 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

I3MT, 3 | 0804, HY, 128206, 25mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hydroxocobalamin ~90% CAS N°13422, 51, 0 | 0572, TRC, H862820, 100MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hoechst | 0037, 40046 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

His, Gly, Gly, OH | 0024, sc, 479198 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hippeastrum hybrid Lectin HHL , Pure | 0468, 21510863, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hexa His tag peptide 5mg | 0607, A6006, 5 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hexa His tag peptide | 0607, A6006, 25 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hepatitis C RDT HCV Rapid Test Cassette | 0920, IHC, 402, 40T | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hemin CAS N°16009, 13, 5; Purity 99.59% | 0931, T5515 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hemin CAS N°16009, 13, 5, Purity >95.0% T | 0941, H0008, 25G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Head and neck cancer tissue array, including pathology grade, TNM and clinical stage AJCC 8th edition , 60 cases/60 cores | 0131, HN602 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

HbA1c Rapid Test Cassette , 10T | 0698, D, HBA1CD10 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Hb+Hb, Hp Combo Rapid Test Cassette | 0920, THPB, 625 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Harringtonine, 10mg | 0607, C4264, 10mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Harringtonine | 0607, C4264, 5 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HSV type 1 Glycosylated aa 21 | 0513, DAG589 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HSD11B2 enzyme; Hydroxysteroid Dehydrogenase, 11, beta, Type I Enzyme 0.1MG | 0544, MBS653798, 0.1MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HRP CONJUGATED SAMBUCUS NIGRA ELDERBERRY BARK , SNA, I, , 1 mg | 0235, H, 6802, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HRP CONJUGATED MAACKIA AMURENSIS LECTIN , MAA, , 1 mg | 0235, H, 7801, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HIV 1.2 Rapid Test Cassette 40T/KIT | 0920, IHI, 402 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HCV Cassette Serum/Plasma , 25 tests/pack | 0826, ABT, IDT, B11 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HBsAg Rapid Test Cassette 50T/kit | 0920, IHBsg, 402, 50t | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HBeAb Rapid Test Cassette Serum/Plasma | 1045, IHBEB, 302 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HBV Combo Rapid Test Cassette | 0920, IHB, 355 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HAV IgM Rapid Test Cassette REF;IHA, 402 25T/kit | 0920, IHA, 402, 25Т | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HAMA blocking reagent 50mg | 0118, 85R, 1001, 50mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HAMA blocking reagent 50mg | 0926, 85R, 1025, 50mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

HAMA blocking reagent | 0926, 85R, 1003 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gum Arabic 2. 20kg // MOQ; 20kg | 0731, EXTZ, 140, 20kg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gum Arabic 1. 20kg // MOQ; 20kg | 0731, EXTZ, 139, 20kg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GsMTx4, 0, 5 mg | 0466, 08GSM001, 00500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GsMTx, 4 Active Peptide 0.1mg | 0544, MBS405925, 0.1mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Griffonia simplicifolia Lectin GSL II | 0468, 21511073, 2 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Greiner 24 Well ComboPlate Case of 24 Plates With Lids | 0414, M, 662150 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gonorrhea Rapid Test Cassette | 1045, CIT, IGO, 502 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glycine max lectin SBA | 0876, 05, 0117, 50mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glycine max Lectin SBA | 0468, 21510010, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glycine max Lectin SBA | 0468, 21761024, 2mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glycerol CAS N°56, 81, 5; Purity; 99.62% | 0931, T4776 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glutaraldehyde CAS# 111, 30, 8 solution, 50% in water | 0862, GC4387, 35L | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glutaraldehyde CAS# 111, 30, 8 solution, 50% in water | 0862, GC4387, 25L | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Glutaraldehyde CAS# 111, 30, 8 solution, 50% in water | 0862, GC4387, 15L | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gliadorphin, 7 | 0121, 4057062, 5mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Givinostat hydrochloride | 0986, B2081, 25 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Germanium Dichloride, Dioxane Complex CAS; 10060, 11, 4 | 1026, 3H, GEG5180, 5G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gentamicin C2 sulfate, EvoPure | 0543, G033, 10MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gentamicin C1a sulfate, EvoPure | 0543, G032, 10MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gentamicin C1 Sulfate, EvoPure | 0543, G031, 10MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Gemcitabine, Free Base, >99%, 500 mg | 0111, G, 4199, 500 MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Galacto, oligosaccharides 25kg // MOQ 25kg | 0731, EXTZ, 159, 1kg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GW 501516 CAS N°317318, 70, 0 Spec | 0931, T6151, 1MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GP2059 Forskolin 10mg | 0862, GP2059, 10MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GERMANIUM DICHLORIDE, DIOXANE COMPLEX CAS; 10060, 11, 4 | 0983, HCH0136721 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

GDC, 0152 | 0804, HY, 13638, 10 mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

G, 1, GPR30 agonist, potent and selective, 10mg | 0607, B5455 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura, 2, pentasodium salt | 0271, 21026, 1mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura, 2, AM Ester | 0037, 50034 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fura Red, potassium salt 1mg | 0271, 21045, 1mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Forsythoside B CAS# 81525, 13, 5 | 0804, HY, N0029, 10MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Forskolin, >99% | 0111, F9929, 50MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Formononetin | 0804, HY, N0183, 5mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

ForMax AMCA Avidin, D Deglycosylated | 0468, 21760038, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folic acid CAS N° 59, 30, 3 | 0931, T0062 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folic acid CAS No 59, 30, 3 | 0926, FF02403, 1KG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Folate, PEG2, amine Cas N°1099829, 15, 8 | 0931, T38492, 100MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fluorescein Active Caspase, 3 Staining Kit | 0607, K2049, 100 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Firsocostat CAS No.; 1434635, 54, 7; Purity; 99.96% , 25mg | 0804, HY, 16901 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Finerenone Synonyms; BAY 94, 8862 , 25 mg | 0804, HY, 111372, 25 mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filipin 25mg | 0543, F020, 25MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filariasis IgG/IgM Rapid Test Cassette | 0920, FIL, 302 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Filariasis IgG/IgM Rapid Test Cassette WB/S / P | 0920, IFIL, 402 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fibronectin Coating Solution | 0171, TM059 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrostatin, 1 Fer, 1 Ferroptosis inhibitor, erastin, induced 5mg | 0607, A4371, 5m | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrocene NHS Ester Amine Reactive Electrochemical Reporter; No. HPT1002 | 0605, HPT1002, 0005 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ferrocene NHS Ester Amine Reactive Electrochemical Reporter; No. HPT1002 | 0605, HPT1002, 0700 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Fentanyl, KLH conjugate 1mg | 0271, 50567, 1mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Falcon 5 mL Round Bottom Polystyrene Test Tube, without Cap, Nonsterile, 1000/Bag, 1000/Case | SLS, 352008 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity; >98% | 0399, CSB, DT0293, 500mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FOXP4 sgRNA CRISPR/Cas9 All, in, One Lentivector set Human | 0171, 20799111 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FMOC, Lys Cy5 , OH, 100mg | 0271, 5055, 100mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FLICA 660 Caspase, 1 Assay Kit | 0246, 9122 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FK 506 100mg | 0111, F, 4900, 100mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, SH, 1K 100mg | 0695, FL044003, 1K, 100mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, OH, 2K 100mg | 0695, FL044002, 2K, 100mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, OH, 10K 100mg | 0695, FL044002, 10K, 100mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, NH2, 100 mg | 0695, FL044005, 1K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, ACA, 2K 100mg | 0695, FL044010, 2K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC, PEG, AC, 2K 100mg | 0695, FL044009, 2K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Glycine max Lectin Soybean , SBA, , 2mg | 0235, F, 1301, 2 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Datura stramonium Lectin Jimson Weed , DSA, , 2mg | 0235, F, 5701, 2 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC Conjugated Anguilla anguilla Lectin Fresh Water Eel , AAA, , 1mg | 0235, F, 4901, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

FITC CONJUGATED AMARANTHUS CAUDATUS LECTIN TASSEL FLOWER, INCA WHEAT , ACA, , 2MG | 0235, F, 8201, 2 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ezatiostat hydrochloride | 0628, A21222, 5mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Evobrutinib | 0804, HY, 101215 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Euonymus europaeus EEL/EEA TRITC Rhodamine | 1058, 518355 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethynyl Estradiol 3, β, D, Glucuronide hydrate | 0931, T36917, 1mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethyl 2, thio, β, D, fructofuranoside CAS N° 80763, 61, 7 | 0862, GC2672, 100MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Ethyl 1, Thio, β, D, glucuronide 250mg | 0572, E926805, 250mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.