Biological Product & Supplies

Daidzein, 5g | 0607, N1862, 5g | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DU 145 | 0683, C0019004 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DSPE, PEG, SC, 2K | 0695, LP096023, 2K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DSPE, PEG, NH2, MW 1, 000, 1G | 0695, BP, 26216, 1G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DSPE, PEG, Mal, 2000 | 0695, LP096022, 2K, 3g | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DSPE, PEG, Galactose ≥95% 2K 1g | 0695, LP096072, 2K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DPM, DMEM/HIGH, 50L | 0928, SH30003.04 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMS273 | 0870, ABC, TC0214 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 1;1, 500 ml 500 ml | 0016, 0410 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 | 0763, PM150312 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 glucose free 500ml | 0763, PM150322, 500ml | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 glucose free without phenol red, L, glutamine, with HEPES | 0763, PM150329 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 glucose free without phenol red 500ml | 0763, PM150324, 500ml | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F12 HBEC, 5i, adapted | 0683, C0013, 17 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM/F, 12, 500 ml | 0683, C0013, 16 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM without glucose, L, glutamine, phenol red and sodium bicarbonate 50L | 0511, DMP52, 50LT | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM High Glucose w/o L, Glutamine w/o Sodium Pyruvate | 0047, LM, D1108/500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM High Glucose w/ L, Glutamine w/o Sodium Pyruvate | 0047, LM, D1109/500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM High Glucose w/ L, Glutamine w/ Sodium Pyruvate | 0047, LM, D1111/500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM Ham’s F12 w/o L, Glutamine, w/o Hepes, w/o Glucose | 0047, LM, D1221 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM | 0047, LM, D1221/500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DMEM | 0047, PM, D1227/1L | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DL, Glyceraldehyde ≥90% GC 1g | 0174, G5001, 1G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DH5a λpir Escherichia coli Strains | 0820, S0120 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DH5a Strains, 100 ul | 0820, STR0002 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DH5a Escherichia coli strains, 100 ul | 0820, S0002 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DH10EMBacY | 0501, DH10EMBacY | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DETERMINE HIV EARLY DETECT | 0173, 7D2847 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DETERMINE HBsAg 2, 20 tests | 0173, TD2946 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DCR Basal Salt Mixture, 50 L | 0468, 30630088, 4 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DBCO, PEG, SC, 2K | 0695, DBCO, PEG, SC, 2K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DBCO, PEG, NHS, 1K | 0695, HE048023, 1K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DB3.1 Escherichia coli Strains 2ul | 0820, S0043 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DAF, 2 DA CAS; 205391, 02, 2| 0271, 16294 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DAB Substrate High Contrast | 0316, ACU250 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

DAB Chromogen Concentrate | 0316, ACB030 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D9, THC, COOH, HRP | OORB00103, 500UL | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, LYSINE MONOHYDROCHLORIDE, 98%, 5X1G | 0072, L07710.06 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, 8147 Duvelisib, Free Base, >99%, 500ug | 0111, D, 8147, 500ug | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, 5678 Dabrafenib, Free Base, >99%, 2g | 0111, D, 5678, 2g | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, + , Trehalose Solution, 1M, 500ml | 0794, AMS.TS1M, 500 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, + , Trehalose Solution, 1M, 100 ml | 0794, AMS.TS1M, 100 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

D, + , Saccharose | 0941, S0111, 500G | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cytophaga Agar Base, 500g | 1124, HDC7731, 500g | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cytomegalovirus Virclia IgM Monotest 24T | 0556, N26, VCM022 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cytokeratin Cocktail CK cocktail , 1.0 ml | 0436, MM, 1012, 02 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 96, well Phagocytosis Assay Zymosan | 0197, CBA, 224 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 96, well In Vitro Tumor Sensitivity Assay Soft Agar Colony Formation , 96Т | 0197, CBA, 150 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 96, well In Vitro Tumor Sensitivity Assay Soft Agar Colony Formation , 5X96 tests | 0197, CBA, 150, 5 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 96, Well Phagocytosis Assay E. coli, Colorimetric Format | 0197, CBA, 222 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 24, well Wound Healing Assay | 0197, CBA, 120, 5 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoSelect 24, well Wound Healing Assay | 0197, CBA, 120 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CytoFix Red Lysosomal Stain | 0271, 23210 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyto, Tek Holder Base 1mL 200/Ca | 0094, 4336 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyto, Tek 1 ml Fluid Chamber, 200/cs | 0094, 4329 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyto, Tek 1 ml Chamber Cap, 200/cs | 0094, 4335 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyt c | Cytochrome c | 0451, AS08 343A | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cynomolgus Monkey PBMCs | 0708, NHP, PC001 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyclosporine A, HRP conjugate 1mg | 0271, Cyclosporine A, HRP conjugate | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cycloheximide Solution 10% in DMSO Sterile , 10 X 1 mL | 0543, C084, 10 X 1ML | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyclic citrullinated peptide, BSA（CCP, BSA）size 100 ug | 0426, E64I00802 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyanine5 maleimide, 50 m | 0051, 53080, 50mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3, dCTP | 0607, B8159, 25ul, 10 mM | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3, dCTP | 0607, B8159, 10ul, 10 mM | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cyanine 3, dCTP | 0607, B8159, 100ul, 10 mM | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CyTCRB, APC | 0733, CYT, BF1AP | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cy5, PEG, SH, 1K, 50 mg | 0695, FL078003, 1K | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cy3 tetrazine | 0220, 910 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service;Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 5 MG | 0399, CSB, CS P , 003 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service;Sequence, MSLKNNIVGFNKLDSEELKNINGGCYPLLIIGALAGIAIRNRIKK 90% purity, 3 mg | 0399, CSB, CS P , 003, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service;Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 5 MG | 0399, CSB, CS P , 005 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Customer service;Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399, SB, CS P , 005, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Customer service;Sequence, MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIYQFGMDQGYRNNKK, 90% purity, 3MG | 0399, CSB, CS P , 005, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Customer service;Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 5 MG | 0399, CSB, CS P , 006 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service;Sequence, MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3MG | 0399, SB, CS P , 006, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Customer service;Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 3MG | 399, CSB, CS P , 004, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service;Sequence, MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG | 0399, CSB, CS P , 004 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Customer service; Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 5 MG | 0399, CSB, CS P , 002 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Customer service; Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN, 90% purity, 3 MG | 0399, CSB, CS P , 002, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's...

Custom peptide; Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399, CSB, CS P , 001, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Custom peptide; Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG | 0399, CSB, CS P , 001 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Custom Service | 0171, Custom, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Custom Oligonucleotide Purification 50, 200nmol scale | 0343, 26, 6400, 77 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cultrex Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear | 0622, 3433, 001, R1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cultrex RGF Basement Membrane Extract, Type 2, | 0622, 3533, 010, 02 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cultrex 3, D Culture Matrix Laminin I 30mg | 0622, 3446, 005, 01, 30mg | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cu/ZnSOD | Cu/Zn superoxide dismutase | 0451, AS18 4243 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystallography Sample Supports SSX24, 50 units | 0414, ML, SXM, B5, 24, 50 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystallography Sample Supports SSX22, 50 units | 0414, ML, SXM, B5, 22, 50 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystallography Sample Supports SSX21, 50 units | 0414, ML, SXM, B5, 21, 50 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystallography Sample Supports SSX1X50 units | 0414, ML, SXM, B5, 13, 50 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystallography Sample Seals, 100 units | 0414, ML, SXM, RTS, 1, 100 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystalgen SuperClear Plates pregreased | 0220, CPL, 132 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Crystal Clear Sealing Film | 1132, HR3, 609 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cryptosporidium spp., 150 test | 0597, Oneq, HA490, 150D | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cryoscope Heat Transfer Fluid , 250mL | 0461, HTF250 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

Cryopreserve Beads Red | 0183, 6087 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CryoVial Tong | 0220, X, CC, 105 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CryoSure, DMSO 6 x 70 ml vials x 10 opak. | 0323, WAK, DMSO, 70x10 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.

CryoSure, DMSO 6 x 70 ml vials | 0323, WAK, DMSO, 70 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.