3, D Life RGD Peptide, 3 x 1 µmol | 0601, P10, 3
- SKU:
- 0601-P10-3
- Availability:
- IN STOCK
Frequently bought together:
Description
3, D Life RGD Peptide, 3 x 1 µmol | 0601, P10, 3 | Genprice Distribution US, UK & Europe
This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
Related Products
3, D Life RGD Peptide 1 µmol | 0601, 09, P, 001
$166.00
3, D Life RGD Peptide 1 µmol | 0601, 09, P, 001 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life SG, Dextran | 0601, M91, 3
$198.00
3, D Life SG, Dextran | 0601, M91, 3 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life FG, Dextran Set | 0601, M92, 3
$200.00
3, D Life FG, Dextran Set | 0601, M92, 3 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life Dextranase 500 µl | 0601, D10, 1
$762.00
3, D Life Dextranase 500 µl | 0601, D10, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life Dextran, CD Hydrogel SG | 0601, G93, 1
$260.00
3, D Life Dextran, CD Hydrogel SG | 0601, G93, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life PEG, Link 3x 200 µl | 0601, L50, 3
$150.00
3, D Life PEG, Link 3x 200 µl | 0601, L50, 3 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
3, D Life Dextran, PEG Hydrogel SG, 1 kit | 0601, G92, 1
$240.00
3, D Life Dextran, PEG Hydrogel SG, 1 kit | 0601, G92, 1 | Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse.
![DiIC18(3)-DS [1, 1-Dioctadecyl-3, 3, 3, 3-tetramethylindocarbocyanine-5, 5-disulfonic acid]](https://cdn11.bigcommerce.com/s-jeqpi38dm3/images/stencil/590x590/products/11095/10293/chemistry-and-science-flasks-with-fluids-chemica-2023-11-27-05-13-00-utc_1__22384.1729336868__52593.1729770418__78424.1730554080.jpg?c=1 "DiIC18(3)-DS [1, 1-Dioctadecyl-3, 3, 3, 3-tetramethylindocarbocyanine-5, 5-disulfonic acid]")
DiIC18 3 , DS [1, 1, Dioctadecyl, 3, 3, 3, 3, tetramethylindocarbocyanine, 5, 5, disulfonic acid] | 0271, 22052
$130.00
DiIC18 3 , DS [1, 1, Dioctadecyl, 3, 3, 3, 3, tetramethylindocarbocyanine, 5, 5, disulfonic acid] | 0271, 22052 | Genprice Distribution US, UK & Europe This product is guaranteed and directly...
Custom peptide; Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399, CSB, CS P , 001, 3MG
$953.00
Custom peptide; Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 90%, 3 MG | 0399, CSB, CS P , 001, 3MG | Genprice Distribution US, UK & Europe This product is guaranteed and...