Compare Quick view trypsin | 0171-TM050 MSRP: Now: $139.00 Was: trypsin | 0171-TM050| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0171-TM050 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $139.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $139.00 Was: Subtotal:
Compare Quick view trans ISRIB - 10 mg | 0622-5284 MSRP: Now: $339.00 Was: trans ISRIB - 10 mg | 0622-5284| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0622-5284 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $339.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $339.00 Was: Subtotal:
Compare Quick view tissue tek Xpress X120 Processing Reagent Set | 0094-7730 MSRP: Now: $1,123.00 Was: tissue tek Xpress X120 Processing Reagent Set | 0094-7730| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0094-7730 Availability: IN STOCK Weight: 1.20 Ounces Size: 4 x 3.8 L MSRP: Now: $1,123.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $1,123.00 Was: Subtotal:
Compare Quick view tdTomato Goat Pab Antibody - 600ug | 0894-AB8181-200 MSRP: Now: $442.00 Was: tdTomato Goat Pab Antibody - 600ug | 0894-AB8181-200| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0894-AB8181-200 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $442.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $442.00 Was: Subtotal:
Compare Quick view tDenHyb 2 For tissue FISH with unique sequence probes | 0310-D102 MSRP: Now: $38,841.00 Was: tDenHyb 2 For tissue FISH with unique sequence probes | 0310-D102| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0310-D102 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 mL MSRP: Now: $38,841.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $38,841.00 Was: Subtotal:
Compare Quick view tDenHyb 1 For general tissue FISH | 0310-D101 MSRP: Now: $279.00 Was: tDenHyb 1 For general tissue FISH | 0310-D101| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0310-D101 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 mL MSRP: Now: $279.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $279.00 Was: Subtotal:
Compare Quick view synomag D streptavidin - 70 nm - 5 mg/ml | 0612-104-19-701 MSRP: Now: $473.00 Was: synomag D streptavidin - 70 nm - 5 mg/ml | 0612-104-19-701| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0612-104-19-701 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 mL MSRP: Now: $473.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $473.00 Was: Subtotal:
Compare Quick view synomag D streptavidin - 50 nm - 5 mg/ml | 0612-104-19-501 MSRP: Now: $473.00 Was: synomag D streptavidin - 50 nm - 5 mg/ml | 0612-104-19-501| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0612-104-19-501 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 mL MSRP: Now: $473.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $473.00 Was: Subtotal:
Compare Quick view stomer service:Sequence - MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW - 90% purity - 3 MG | 0399-CSB-CS(P)-006-3MG MSRP: Now: $926.00 Was: stomer service:Sequence - MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW - 90% purity - 3 MG | 0399-CSB-CS(P)-006-3MG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-CS(P)-006-3MG Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $926.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $926.00 Was: Subtotal:
Compare Quick view soluble epoxide hydrolase; ~100 U/mg | 0731-EXWM-3995-50Āµg MSRP: Now: $2,200.00 Was: soluble epoxide hydrolase; ~100 U/mg | 0731-EXWM-3995-50Āµg| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0731-EXWM-3995-50Āµg Availability: IN STOCK Weight: 1.20 Ounces Size: 50 Āµg MSRP: Now: $2,200.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $2,200.00 Was: Subtotal:
Compare Quick view smURFP N1 plasmid - 2ug | 0820-PVT40117 MSRP: Now: $506.00 Was: smURFP N1 plasmid - 2ug | 0820-PVT40117| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT40117 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $506.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $506.00 Was: Subtotal:
Compare Quick view shp53 pLKO.1 puro Plasmid - 2 ug | 0820-PVT18229 MSRP: Now: $3,354.00 Was: shp53 pLKO.1 puro Plasmid - 2 ug | 0820-PVT18229| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT18229 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,354.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,354.00 Was: Subtotal:
Compare Quick view Antibody to rgpB - HRP conjugated | 0399-CSB-PA310587LB01EYA-50UG MSRP: Now: $375.00 Was: Antibody to rgpB - HRP conjugated | 0399-CSB-PA310587LB01EYA-50UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-PA310587LB01EYA-50UG Availability: IN STOCK Weight: 1.20 Ounces Size: 50 ug MSRP: Now: $375.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $375.00 Was: Subtotal:
Compare Quick view Antibody to rgpB - HRP conjugated | 0399-CSB-PA310587LB01EYA-100UG MSRP: Now: $52,025.00 Was: Antibody to rgpB - HRP conjugated | 0399-CSB-PA310587LB01EYA-100UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-PA310587LB01EYA-100UG Availability: IN STOCK Weight: 1.20 Ounces Size: 100ug MSRP: Now: $52,025.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $52,025.00 Was: Subtotal:
Compare Quick view Antibody to rgpB | 0399- CSB-PA310587LA01EYA-50mg MSRP: Now: $483.00 Was: Antibody to rgpB | 0399- CSB-PA310587LA01EYA-50mg| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399- CSB-PA310587LA01EYA-50mg Availability: IN STOCK Weight: 1.20 Ounces Size: 50ug MSRP: Now: $483.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $483.00 Was: Subtotal:
Compare Quick view Antibody to rgpB | 0399-CSB-PA310587LA01EYA-100ug MSRP: Now: $425.00 Was: Antibody to rgpB | 0399-CSB-PA310587LA01EYA-100ug| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-PA310587LA01EYA-100ug Availability: IN STOCK Weight: 1.20 Ounces Size: 100ug MSRP: Now: $425.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $425.00 Was: Subtotal:
Compare Quick view rgpA Antibody - 50 ug | 0399-CSB-PA338957LA01PQP-50UG MSRP: Now: $289.00 Was: rgpA Antibody - 50 ug | 0399-CSB-PA338957LA01PQP-50UG| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-PA338957LA01PQP-50UG Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $289.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $289.00 Was: Subtotal:
Compare Quick view Antibody to rgpA | 0399-CSB-PA338957LA01PQP MSRP: Now: $467.00 Was: Antibody to rgpA | 0399-CSB-PA338957LA01PQP| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0399-CSB-PA338957LA01PQP Availability: IN STOCK Weight: 1.20 Ounces Size: 100ug MSRP: Now: $467.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $467.00 Was: Subtotal:
Compare Quick view rHu IL2 - 3MIU | 0004-RHIL2-08F02 MSRP: Now: $249.00 Was: rHu IL2 - 3MIU | 0004-RHIL2-08F02| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0004-RHIL2-08F02 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $249.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $249.00 Was: Subtotal:
Compare Quick view rAAV GfaABC1D ChrimsonR mCherry WPRE SV40 pA - AAV2/5 ā„5.00E+12vg/mL | 1067-PT-7019-40Āµl MSRP: Now: $695.00 Was: rAAV GfaABC1D ChrimsonR mCherry WPRE SV40 pA - AAV2/5 ā„5.00E+12vg/mL | 1067-PT-7019-40Āµl| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 1067-PT-7019-40Āµl Availability: IN STOCK Weight: 1.20 Ounces Size: 40 uL MSRP: Now: $695.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $695.00 Was: Subtotal:
Compare Quick view r KSTI - 1 mg | 0963-NRPA29S-1 MSRP: Now: $1,677.00 Was: r KSTI - 1 mg | 0963-NRPA29S-1| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0963-NRPA29S-1 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $1,677.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $1,677.00 Was: Subtotal:
Compare Quick view qPCR Probe Master Mix | 0813-Q112-02 MSRP: Now: $241.00 Was: qPCR Probe Master Mix | 0813-Q112-02| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0813-Q112-02 Availability: IN STOCK Weight: 1.20 Ounces Size: 500 reactions MSRP: Now: $241.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $241.00 Was: Subtotal:
Compare Quick view qPCR Probe Master Mix | 0813-Q112-03 MSRP: Now: $1,087.00 Was: qPCR Probe Master Mix | 0813-Q112-03| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0813-Q112-03 Availability: IN STOCK Weight: 1.20 Ounces Size: 2500 reactions MSRP: Now: $1,087.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $1,087.00 Was: Subtotal:
Compare Quick view proDynorphin | 0089-GP10110-50 ul MSRP: Now: $560.00 Was: proDynorphin | 0089-GP10110-50 ul| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0089-GP10110-50 ul Availability: IN STOCK Weight: 1.20 Ounces Size: 50 uL MSRP: Now: $560.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $560.00 Was: Subtotal:
Compare Quick view pmCherry C1 plasmid | 0820-PVT1233 MSRP: Now: $462.00 Was: pmCherry C1 plasmid | 0820-PVT1233| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT1233 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $462.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $462.00 Was: Subtotal:
Compare Quick view perimag plain - 130 nm - 25 mg/ml | 0612-102-00-132 MSRP: Now: $374.00 Was: perimag plain - 130 nm - 25 mg/ml | 0612-102-00-132| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0612-102-00-132 Availability: IN STOCK Weight: 1.20 Ounces Size: 10 mL MSRP: Now: $374.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $374.00 Was: Subtotal:
Compare Quick view pcDNA3.1 WASF2 | 0820-PVT51408 MSRP: Now: $600.00 Was: pcDNA3.1 WASF2 | 0820-PVT51408| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT51408 Availability: IN STOCK Weight: 1.20 Ounces Size: 2ug(Lyophilized powder) MSRP: Now: $600.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $600.00 Was: Subtotal:
Compare Quick view pcDNA3.1 KCNMA1 | 0820-PVT51407 MSRP: Now: $600.00 Was: pcDNA3.1 KCNMA1 | 0820-PVT51407| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT51407 Availability: IN STOCK Weight: 1.20 Ounces Size: 2ug(Lyophilized powder) MSRP: Now: $600.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $600.00 Was: Subtotal:
Compare Quick view pcDNA3.1 HA Ubiquitin Plasmid - 2 ug | 0820-PVTB00017-2e MSRP: Now: $446.00 Was: pcDNA3.1 HA Ubiquitin Plasmid - 2 ug | 0820-PVTB00017-2e| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTB00017-2e Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $446.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $446.00 Was: Subtotal:
Compare Quick view pcDNA3.1 Flag RELA Plasmid - 2 ug | 0820-PVTB00135-2d MSRP: Now: $4,628.00 Was: pcDNA3.1 Flag RELA Plasmid - 2 ug | 0820-PVTB00135-2d| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTB00135-2d Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $4,628.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $4,628.00 Was: Subtotal:
Compare Quick view pan HPV BIO DNA probe | 0784-A100P.0100 MSRP: Now: $832.00 Was: pan HPV BIO DNA probe | 0784-A100P.0100| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0784-A100P.0100 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $832.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $832.00 Was: Subtotal:
Compare Quick view pYES3/ CT - 2 ug | 0820-PVT11237 MSRP: Now: $3,913.00 Was: pYES3/ CT - 2 ug | 0820-PVT11237| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11237 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,913.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,913.00 Was: Subtotal:
Compare Quick view pYES DEST52 | 0820-PVT22154 MSRP: Now: $506.00 Was: pYES DEST52 | 0820-PVT22154| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT22154 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $506.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $506.00 Was: Subtotal:
Compare Quick view pYD1 | 0820-PVT11284 MSRP: Now: $472.00 Was: pYD1 | 0820-PVT11284| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11284 Availability: IN STOCK Weight: 1.20 Ounces Size: 2ug MSRP: Now: $472.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $472.00 Was: Subtotal:
Compare Quick view pWB980 - 2 ug | 0820-PVT5015 MSRP: Now: $576.00 Was: pWB980 - 2 ug | 0820-PVT5015| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5015 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $576.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $576.00 Was: Subtotal:
Compare Quick view pUZ8002 plasmid | 0820-PVT12448 MSRP: Now: $486.00 Was: pUZ8002 plasmid | 0820-PVT12448| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT12448 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $486.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $486.00 Was: Subtotal:
Compare Quick view pUTKM1 plasmid | 0820-PVT6021 MSRP: Now: $311.00 Was: pUTKM1 plasmid | 0820-PVT6021| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT6021 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $311.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $311.00 Was: Subtotal:
Compare Quick view pUCP18 | 0820-PVT33533 MSRP: Now: $436.00 Was: pUCP18 | 0820-PVT33533| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT33533 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $436.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $436.00 Was: Subtotal:
Compare Quick view pUC57 Kan | 0820-PVT10562 MSRP: Now: $389.00 Was: pUC57 Kan | 0820-PVT10562| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10562 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $389.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $389.00 Was: Subtotal:
Compare Quick view pTargetF | 0820-PVT10638 MSRP: Now: $427.00 Was: pTargetF | 0820-PVT10638| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10638 Availability: IN STOCK Weight: 1.20 Ounces Size: 2Āµg MSRP: Now: $427.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $427.00 Was: Subtotal:
Compare Quick view pTT5 | 0820-PVTY00298 MSRP: Now: $510.00 Was: pTT5 | 0820-PVTY00298| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY00298 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $510.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $510.00 Was: Subtotal:
Compare Quick view pTA7001 DEST plasmid | 0820-PVT11163 MSRP: Now: $358.00 Was: pTA7001 DEST plasmid | 0820-PVT11163| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11163 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $358.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $358.00 Was: Subtotal:
Compare Quick view pT7 His TNF | 0820-PVT10122 MSRP: Now: $428.00 Was: pT7 His TNF | 0820-PVT10122| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10122 Availability: IN STOCK Weight: 1.20 Ounces Size: 2Āµg MSRP: Now: $428.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $428.00 Was: Subtotal:
Compare Quick view pT3 EF1a NICD1 m | 0820-PVT17623 MSRP: Now: $387.00 Was: pT3 EF1a NICD1 m | 0820-PVT17623| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT17623 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $387.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $387.00 Was: Subtotal:
Compare Quick view pSilent 1 Plasmid | 0820-PVT5309 MSRP: Now: $421.00 Was: pSilent 1 Plasmid | 0820-PVT5309| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5309 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $421.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $421.00 Was: Subtotal:
Compare Quick view pRSETC - 2 ug | 0820-PVT0815 MSRP: Now: $4,225.00 Was: pRSETC - 2 ug | 0820-PVT0815| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT0815 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $4,225.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $4,225.00 Was: Subtotal:
Compare Quick view pRSETB - 2 UG | 0820-PVT11609 MSRP: Now: $3,952.00 Was: pRSETB - 2 UG | 0820-PVT11609| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11609 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,952.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,952.00 Was: Subtotal:
Compare Quick view pRSETB Plasmid - 2 ug | 0820-PVT0814 MSRP: Now: $4,425.00 Was: pRSETB Plasmid - 2 ug | 0820-PVT0814| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT0814 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $4,425.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $4,425.00 Was: Subtotal:
Compare Quick view pRSET6A - 2 ug | 0820-PVT10612 MSRP: Now: $3,913.00 Was: pRSET6A - 2 ug | 0820-PVT10612| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10612 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,913.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,913.00 Was: Subtotal:
Compare Quick view pRSET C - 2 ug | 0820-PVTY01162 MSRP: Now: $439.00 Was: pRSET C - 2 ug | 0820-PVTY01162| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY01162 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $439.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $439.00 Was: Subtotal:
Compare Quick view pRSET B - 2 ug | 0820-PVTY01161 MSRP: Now: $439.00 Was: pRSET B - 2 ug | 0820-PVTY01161| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY01161 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $439.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $439.00 Was: Subtotal:
Compare Quick view pRSET A - 2 ug | 0820-PVTY01160 MSRP: Now: $406.00 Was: pRSET A - 2 ug | 0820-PVTY01160| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY01160 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $406.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $406.00 Was: Subtotal:
Compare Quick view pRS426 | 0820-PVT4047 MSRP: Now: $410.00 Was: pRS426 | 0820-PVT4047| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT4047 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $410.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $410.00 Was: Subtotal:
Compare Quick view pRK5 Plasmid - 2 ug | 0820-PVT48959 MSRP: Now: $489.00 Was: pRK5 Plasmid - 2 ug | 0820-PVT48959| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT48959 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $489.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $489.00 Was: Subtotal:
Compare Quick view pRI101 AN - 2 ug | 0820-PVT11185 MSRP: Now: $481.00 Was: pRI101 AN - 2 ug | 0820-PVT11185| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11185 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $481.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $481.00 Was: Subtotal:
Compare Quick view pRGEB32 - 2 ug | 0820-PVT11209 MSRP: Now: $292.00 Was: pRGEB32 - 2 ug | 0820-PVT11209| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11209 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $292.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $292.00 Was: Subtotal:
Compare Quick view pREP4 Plasmid - 2 ug | 0820-PVT5708 MSRP: Now: $359.00 Was: pREP4 Plasmid - 2 ug | 0820-PVT5708| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5708 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $359.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $359.00 Was: Subtotal:
Compare Quick view pRE112 Plasmid - 2 ug | 0820-PVT6020 MSRP: Now: $4,225.00 Was: pRE112 Plasmid - 2 ug | 0820-PVT6020| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT6020 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $4,225.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $4,225.00 Was: Subtotal:
Compare Quick view pQE TriSystem - 2 ug | 0820-PVT0544 MSRP: Now: $576.00 Was: pQE TriSystem - 2 ug | 0820-PVT0544| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT0544 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $576.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $576.00 Was: Subtotal:
Compare Quick view pProEX HTA plasmid | 0820-PVT0373 MSRP: Now: $316.00 Was: pProEX HTA plasmid | 0820-PVT0373| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT0373 Availability: IN STOCK Weight: 1.20 Ounces Size: 2ug MSRP: Now: $316.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $316.00 Was: Subtotal:
Compare Quick view pPR3 N plasmid | 0820-PVT11260 MSRP: Now: $301.00 Was: pPR3 N plasmid | 0820-PVT11260| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11260 Availability: IN STOCK Weight: 1.20 Ounces Size: 2ug MSRP: Now: $301.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $301.00 Was: Subtotal:
Compare Quick view pOTB7 2ug Lyophilized powder | 0820-pOTB7-CUST MSRP: Now: $426.00 Was: pOTB7 2ug Lyophilized powder | 0820-pOTB7-CUST| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-pOTB7-CUST Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $426.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $426.00 Was: Subtotal:
Compare Quick view pOET1.1C_6xHis transfer plasmid | 0514-2001012 MSRP: Now: $730.00 Was: pOET1.1C_6xHis transfer plasmid | 0514-2001012| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0514-2001012 Availability: IN STOCK Weight: 1.20 Ounces Size: 10 Āµg MSRP: Now: $730.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $730.00 Was: Subtotal:
Compare Quick view pOET1.1 Transfer Plasmid | 0514-200101 MSRP: Now: $241.00 Was: pOET1.1 Transfer Plasmid | 0514-200101| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0514-200101 Availability: IN STOCK Weight: 1.20 Ounces Size: 10 Āµg MSRP: Now: $241.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $241.00 Was: Subtotal:
Compare Quick view pNZ8148 Plasmid - 2 ug | 0820-PVT5205 MSRP: Now: $560.00 Was: pNZ8148 Plasmid - 2 ug | 0820-PVT5205| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5205 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $560.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $560.00 Was: Subtotal:
Compare Quick view pNZ8048 | 0820-PVT5204 MSRP: Now: $430.00 Was: pNZ8048 | 0820-PVT5204| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5204 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $430.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $430.00 Was: Subtotal:
Compare Quick view pMito.iGABASnFR 2 ug | 0820-PVT39758 MSRP: Now: $484.00 Was: pMito.iGABASnFR 2 ug | 0820-PVT39758| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT39758 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $484.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $484.00 Was: Subtotal:
Compare Quick view pMal c5X Plasmid 2ug | 0820-PVT0409 MSRP: Now: $365.00 Was: pMal c5X Plasmid 2ug | 0820-PVT0409| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT0409 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $365.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $365.00 Was: Subtotal:
Compare Quick view pMaCTag P05 | 0820-PVT18000 MSRP: Now: $405.00 Was: pMaCTag P05 | 0820-PVT18000| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT18000 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $405.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $405.00 Was: Subtotal:
Compare Quick view pMIGR1 smURFP murine Rela m p65 2ug | 0820-PVT27330 MSRP: Now: $506.00 Was: pMIGR1 smURFP murine Rela m p65 2ug | 0820-PVT27330| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT27330 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $506.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $506.00 Was: Subtotal:
Compare Quick view pMIGR1 SmurFP ReLa m PL5 2ug | 0820-PVT14494 MSRP: Now: $986.00 Was: pMIGR1 SmurFP ReLa m PL5 2ug | 0820-PVT14494| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT14494 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $986.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $986.00 Was: Subtotal:
Compare Quick view pMET Š | 0820-PVTY00803 MSRP: Now: $481.00 Was: pMET Š | 0820-PVTY00803| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY00803 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $481.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $481.00 Was: Subtotal:
Compare Quick view pMES4 Plasmid - 2 ug | 0820- PVT15975 MSRP: Now: $381.00 Was: pMES4 Plasmid - 2 ug | 0820- PVT15975| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820- PVT15975 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $381.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $381.00 Was: Subtotal:
Compare Quick view pMC.EF1 MCS SV40polyA | 0322-MN502A-1 MSRP: Now: $10,325.00 Was: pMC.EF1 MCS SV40polyA | 0322-MN502A-1| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0322-MN502A-1 Availability: IN STOCK Weight: 1.20 Ounces Size: 10 Āµg MSRP: Now: $10,325.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $10,325.00 Was: Subtotal:
Compare Quick view pMAL c5X 2ug | 0820-PVTY00501 MSRP: Now: $506.00 Was: pMAL c5X 2ug | 0820-PVTY00501| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVTY00501 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $506.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $506.00 Was: Subtotal:
Compare Quick view pLVX EF1? IRES EGFP PGK Puro - 2 ug | 0820-PVT11071 MSRP: Now: $481.00 Was: pLVX EF1? IRES EGFP PGK Puro - 2 ug | 0820-PVT11071| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11071 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $481.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $481.00 Was: Subtotal:
Compare Quick view pLVX CMV LYRM4 PGK Puro plasmid | 0820-PVT33786 MSRP: Now: $486.00 Was: pLVX CMV LYRM4 PGK Puro plasmid | 0820-PVT33786| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT33786 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $486.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $486.00 Was: Subtotal:
Compare Quick view pLVX CMV IRES RFP Puro 2ug | 0820-PVT25904 MSRP: Now: $506.00 Was: pLVX CMV IRES RFP Puro 2ug | 0820-PVT25904| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT25904 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $506.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $506.00 Was: Subtotal:
Compare Quick view pLVX AcGFP1 N1 | 0820-PVT2311 MSRP: Now: $3,133.00 Was: pLVX AcGFP1 N1 | 0820-PVT2311| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT2311 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,133.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,133.00 Was: Subtotal:
Compare Quick view pLVX Tight Puro Plasmid 2ug | 0820-PVT2313 MSRP: Now: $365.00 Was: pLVX Tight Puro Plasmid 2ug | 0820-PVT2313| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT2313 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $365.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $365.00 Was: Subtotal:
Compare Quick view pLVX IRES mCherry Plasmid | 0820-PVT2307 MSRP: Now: $430.00 Was: pLVX IRES mCherry Plasmid | 0820-PVT2307| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT2307 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $430.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $430.00 Was: Subtotal:
Compare Quick view pLVX IRES Neo 2ug | 0820-PVT11065 MSRP: Now: $428.00 Was: pLVX IRES Neo 2ug | 0820-PVT11065| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11065 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $428.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $428.00 Was: Subtotal:
Compare Quick view pLVX DsRed Monomer N1 | 0820-PVT2312 MSRP: Now: $428.00 Was: pLVX DsRed Monomer N1 | 0820-PVT2312| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT2312 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $428.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $428.00 Was: Subtotal:
Compare Quick view pLVML 3*Flag MCS IRES Puro | 0820-PVT11064-2ug MSRP: Now: $318.00 Was: pLVML 3*Flag MCS IRES Puro | 0820-PVT11064-2ug| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11064-2ug Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $318.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $318.00 Was: Subtotal:
Compare Quick view pLV2 EF1a GUCY2CCynomolgus opt 3ĆFLAG Puro Plasmid lyophilized powder 2ug except with a GFP tag instead of the FLAG tag | 0820-PVT48796-GFP MSRP: Now: $625.00 Was: pLV2 EF1a GUCY2CCynomolgus opt 3ĆFLAG Puro Plasmid lyophilized powder 2ug except with a GFP tag instead of the FLAG tag | 0820-PVT48796-GFP| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by... SKU: 0820-PVT48796-GFP Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $625.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $625.00 Was: Subtotal:
Compare Quick view pLV2 EF1a GUCY2CCynomolgus opt 3ĆāFLAG Puro Plasmid - 2 ug | 0820-PVT48796 MSRP: Now: $435.00 Was: pLV2 EF1a GUCY2CCynomolgus opt 3ĆāFLAG Puro Plasmid - 2 ug | 0820-PVT48796| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT48796 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $435.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $435.00 Was: Subtotal:
Compare Quick view pLV mCherry - 2 ug | 0820-PVT11094 MSRP: Now: $3,913.00 Was: pLV mCherry - 2 ug | 0820-PVT11094| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11094 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,913.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,913.00 Was: Subtotal:
Compare Quick view pLKO.1 Hygro - 2 ug | 0820-PVT11107 MSRP: Now: $3,913.00 Was: pLKO.1 Hygro - 2 ug | 0820-PVT11107| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11107 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,913.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,913.00 Was: Subtotal:
Compare Quick view pLKO.1 EGFP Puro | 0820-PVT11103 MSRP: Now: $3,913.00 Was: pLKO.1 EGFP Puro | 0820-PVT11103| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT11103 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $3,913.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $3,913.00 Was: Subtotal:
Compare Quick view pKD46 plasmid | 0820-PVT6005 MSRP: Now: $4,225.00 Was: pKD46 plasmid | 0820-PVT6005| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT6005 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $4,225.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $4,225.00 Was: Subtotal:
Compare Quick view pKD3 plasmid | 0820-PVT6001 MSRP: Now: $409.00 Was: pKD3 plasmid | 0820-PVT6001| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT6001 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $409.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $409.00 Was: Subtotal:
Compare Quick view pKC1139 Plasmid | 0820-PVT6009 MSRP: Now: $473.00 Was: pKC1139 Plasmid | 0820-PVT6009| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT6009 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $473.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $473.00 Was: Subtotal:
Compare Quick view pJV53 | 0820-PVT10523 MSRP: Now: $430.00 Was: pJV53 | 0820-PVT10523| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10523 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $430.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $430.00 Was: Subtotal:
Compare Quick view pIZT/ V5 His plasmid | 0820-PVT5106 MSRP: Now: $360.00 Was: pIZT/ V5 His plasmid | 0820-PVT5106| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5106 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 ug MSRP: Now: $360.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $360.00 Was: Subtotal:
Compare Quick view pIRES2 DsRed2 2ug | 0820-PVT10757 MSRP: Now: $458.00 Was: pIRES2 DsRed2 2ug | 0820-PVT10757| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT10757 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $458.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $458.00 Was: Subtotal:
Compare Quick view pHelper | 0820-PVT2101 MSRP: Now: $28,493.00 Was: pHelper | 0820-PVT2101| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT2101 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Piece MSRP: Now: $28,493.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $28,493.00 Was: Subtotal:
Compare Quick view pHT08 Plasmid | 0820-PVT5003 MSRP: Now: $410.00 Was: pHT08 Plasmid | 0820-PVT5003| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5003 Availability: IN STOCK Weight: 1.20 Ounces Size: 2 Āµg MSRP: Now: $410.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $410.00 Was: Subtotal:
Compare Quick view pHT01 Plasmid 2ug | 0820-PVT5001 MSRP: Now: $435.00 Was: pHT01 Plasmid 2ug | 0820-PVT5001| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5001 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $435.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $435.00 Was: Subtotal:
Compare Quick view pHCMC05 Plasmid | 0820-PVT5012 MSRP: Now: $512.00 Was: pHCMC05 Plasmid | 0820-PVT5012| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0820-PVT5012 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $512.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $512.00 Was: Subtotal:
Compare Quick view pH Sensor InLab Science | 0072-662-2837 MSRP: Now: $539.00 Was: pH Sensor InLab Science | 0072-662-2837| Genprice Distribution US, UK & Europe This product is guaranteed and directly supplied to your lab by Gentaur's warehouse. SKU: 0072-662-2837 Availability: IN STOCK Weight: 1.20 Ounces Size: 1 Unit MSRP: Now: $539.00 Was: Compare Quick view Qty in Cart: 0 Price: MSRP: Now: $539.00 Was: Subtotal: